PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv6_133680_nuri.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family MIKC_MADS
Protein Properties Length: 227aa    MW: 25656.9 Da    PI: 5.2617
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv6_133680_nuri.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.81.5e-28959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        k+i+n++ rqvtfskRr g++KKAeELSvLCda+va++ifs tgkl+eyss
  Bv6_133680_nuri.t1  9 KKIDNTTARQVTFSKRRRGLFKKAEELSVLCDADVALVIFSATGKLFEYSS 59
                        68***********************************************96 PP

2K-box49.51.9e-17921711998
               K-box  19 qelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                          +++ L++ei    +++Rh+ Ge+L+ L ++eLqqLe+ Le +lk++ +kK e ++++i+ l +k  +l een+ Lr+++
  Bv6_133680_nuri.t1  92 SNYTELNEEIARKSQQLRHMRGEELQGLGIEELQQLEKSLEFGLKHVMDKKGEKITNEIDLLEQKGAKLMEENEWLRQQV 171
                         568889999999999***************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.6E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.235161IPR002100Transcription factor, MADS-box
CDDcd002654.88E-39275No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-30374IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-27323IPR002100Transcription factor, MADS-box
PfamPF003199.5E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-273859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.52787177IPR002487Transcription factor, K-box
PfamPF014861.4E-1592171IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009910Biological Processnegative regulation of flower development
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0030154Biological Processcell differentiation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048438Biological Processfloral whorl development
GO:0005634Cellular Componentnucleus
GO:0000900Molecular Functiontranslation repressor activity, nucleic acid binding
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MAREKIQIKK IDNTTARQVT FSKRRRGLFK KAEELSVLCD ADVALVIFSA TGKLFEYSSS  60
SMKTILEKHK LHSKNLDKLE QPSLKLQLVE NSNYTELNEE IARKSQQLRH MRGEELQGLG  120
IEELQQLEKS LEFGLKHVMD KKGEKITNEI DLLEQKGAKL MEENEWLRQQ VLEASKGTQQ  180
AADSDYVVYE EGQSSESISN GYSSGGTSQD CDEGSDTYLK LGLPYSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-19173173Myocyte-specific enhancer factor 2B
1tqe_Q1e-19173173Myocyte-specific enhancer factor 2B
1tqe_R1e-19173173Myocyte-specific enhancer factor 2B
1tqe_S1e-19173173Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00272DAPTransfer from AT2G22540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010680338.11e-165PREDICTED: MADS-box protein JOINTLESS
SwissprotQ9FUY61e-100JOIN_SOLLC; MADS-box protein JOINTLESS
TrEMBLA0A0J8CB891e-165A0A0J8CB89_BETVU; Uncharacterized protein
STRINGVIT_00s0313g00070.t011e-109(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.13e-77MIKC_MADS family protein